Hydrophobicity & Membrane Interactions

Understanding how peptides interact with lipid membranes

Advertisement

Contents

What is Hydrophobicity?

Hydrophobicity (from Greek: hydro = water, phobos = fear) describes the tendency of nonpolar molecules or molecular regions to avoid contact with water and instead associate with other nonpolar entities, including lipid membranes.

The Hydrophobic Effect

The hydrophobic effect is fundamentally entropy-driven, not "water-hating." When nonpolar molecules dissolve in water, water molecules must form ordered cage-like structures (clathrates) around them, which decreases entropy. By clustering together, hydrophobic molecules minimize the ordered water surface, increasing overall system entropy.

Unfavorable: Dispersed
Many ordered water cages
Low entropy ΔS < 0
Favorable: Clustered
Fewer ordered water cages
High entropy ΔS > 0

Thermodynamics:
ΔG = ΔH - TΔS
For the hydrophobic effect: ΔH ≈ 0, but TΔS > 0 (favorable entropy increase)
Therefore: ΔG < 0 (spontaneous clustering)

Hydropathy Scales: Quantifying Hydrophobicity

Several scales have been developed to assign numerical hydrophobicity values to amino acids. Each scale is based on different experimental approaches:

Kyte-Doolittle Scale

Method: Based on vapor-phase transfer and protein structure analysis
Range: -4.5 (Arg, most hydrophilic) to +4.5 (Ile, most hydrophobic)
Use: Predicting transmembrane regions in proteins
Published: 1982

Eisenberg Scale

Method: Normalized consensus from multiple hydrophobicity scales
Range: -1.0 to +1.0 (normalized)
Use: Helical wheel projections, amphipathicity analysis
Published: 1984

Wimley-White Scale

Method: Experimental water→membrane transfer free energy (ΔG)
Range: -1.0 to +3.0 kcal/mol
Use: Most accurate for membrane insertion predictions
Published: 1996
Why PepDraw uses it: Direct thermodynamic measurement, most biologically relevant

Interpreting ΔG Values (Wimley-White)

Understanding Transfer Free Energy

The Wimley-White scale reports the free energy change (ΔG) for transferring an amino acid from water into a lipid bilayer interface, measured in kcal/mol:

ΔG > +1.5 kcal/mol
Very hydrophilic
Strongly resists membrane insertion
Examples: Arg (+2.5), Lys (+2.8), Asp (+3.6)
ΔG ≈ 0 kcal/mol
Neutral / Ambivalent
No preference for water or membrane
Examples: Gly (-0.01), Thr (0.14), Ser (0.13)
ΔG < -1.0 kcal/mol
Very hydrophobic
Strongly favors membrane insertion
Examples: Phe (-1.71), Leu (-2.28), Ile (-1.12)

For peptides: Sum the ΔG values for all residues. More negative = more hydrophobic = greater tendency to partition into membranes.

Measuring Hydrophobicity

Hydrophobicity can be measured experimentally or calculated from sequence. Each method provides different but complementary information.

Experimental Methods

1. Partition Coefficient (octanol/water)

Principle: Measure the distribution of a peptide between water and octanol (a nonpolar solvent that mimics membrane interior).

P = [peptide]octanol / [peptide]water

log P > 0: Hydrophobic (prefers octanol)
log P < 0: Hydrophilic (prefers water)

Advantages: Direct thermodynamic measurement
Limitations: Octanol ≠ real membrane (lacks charge, different structure)

2. Retention in Reverse-Phase HPLC

Principle: Hydrophobic peptides bind more strongly to the nonpolar stationary phase and elute later (longer retention time).

Advantages: Easy, fast, reproducible, correlates well with membrane affinity
Use: Predict membrane-binding peptides, optimize synthesis

3. Transfer Free Energy (Wimley-White Method)

Principle: Directly measure the energy required to move peptide from water into lipid vesicles using equilibrium dialysis or isothermal titration calorimetry (ITC).

Advantages: Most biologically relevant, accounts for real membrane properties
Gold standard: This is how Wimley-White scale was derived

Calculated vs Experimental Hydrophobicity

Important Limitations

Calculated hydrophobicity (summing per-residue values) assumes:

  • Additivity: Each residue contributes independently (not always true!)
  • No context effects: Ignores neighboring residues and 3D structure
  • Linear peptides: Doesn't account for folding, cyclic structures, or disulfides
  • No charge effects: Actual insertion depends heavily on membrane charge and pH

Reality: Calculated values are useful estimates but can differ significantly from experimental measurements. For critical applications, validate experimentally!

The Amphipathic Helix

An amphipathic helix (also called amphiphilic helix) is an α-helix with distinct hydrophobic and hydrophilic faces. This structural motif is crucial for membrane interactions and protein function.

Structure and Properties

Amphipathic helix representation

Key Features:

  • Periodicity: α-helix has 3.6 residues per turn
  • i, i+3, i+4 pattern: Residues ~100° apart face same direction
  • Segregation: Hydrophobic residues cluster on one face, polar on other
  • Stability: Amphipathic helices are stable at membrane interfaces

Helical Wheel Projections

A helical wheel is a 2D projection looking down the helix axis, showing which residues face which direction. This visualization reveals amphipathicity:

How to Read a Helical Wheel

  • Each residue is plotted at 100° intervals (360°/3.6 residues)
  • Residue 1 at top (12 o'clock)
  • Residue 2 at ~100° clockwise
  • Residue 3 at ~200° clockwise
  • Residue 4 nearly below residue 1 (~300°)
  • Color-code by property: blue (hydrophobic), red (charged), green (polar)

Identifying Amphipathicity

  • Perfect amphipathic: Clear separation into two hemispheres
  • Partial amphipathic: Some segregation but not perfect
  • Non-amphipathic: Random distribution of properties
  • Hydrophobic moment (μH): Vector sum quantifies amphipathicity

Importance in Biology

Membrane Proteins
Amphipathic helices sit at membrane-water interface with hydrophobic face buried in lipids and hydrophilic face exposed to water. Critical for voltage-gated channels, GPCRs, and transporters.
Antimicrobial Peptides
Most antimicrobial peptides (AMPs) adopt amphipathic helices upon membrane binding. The hydrophobic face inserts into membrane while charged face interacts with lipid headgroups, destabilizing the bilayer.
Lipid-Binding Domains
Apolipoproteins (like ApoA-I in HDL) use amphipathic helices to bind and solubilize lipids. The helix wraps around lipid droplets with hydrophobic face pointing inward.
Cell-Penetrating Peptides
Many CPPs (e.g., Penetratin, MAP) form amphipathic helices that facilitate membrane crossing. The balance of charge and hydrophobicity is critical for uptake efficiency.
Advertisement

Melittin: A Case Study

Melittin is the principal toxic component of bee venom and serves as the archetypal amphipathic, membrane-disrupting peptide. Its well-studied properties make it an ideal teaching example.

Melittin Sequence
GIGAVLKVLTTGLPALISWIKRKRQQ
26 amino acids | MW: 2,846 Da | pI: 12.5 | Net charge at pH 7.4: +5.0

Structural Properties

Primary Structure

  • N-terminal (1-20): Predominantly hydrophobic
  • C-terminal (21-26): Highly cationic (2 Lys + 2 Arg)
  • Proline at position 14: Creates kink in helix
  • No disulfide bonds: Linear peptide
  • C-terminus amidated: –CONH₂ (natural modification)

Secondary Structure

  • In water: Mostly random coil (unstructured)
  • At membranes: Adopts α-helical conformation
  • Bent helix: Residues 1-10 and 13-26 (bent at Pro14)
  • Amphipathic: Strong segregation of hydrophobic/hydrophilic faces
  • Membrane-induced folding: Structure forms upon lipid binding

Charge Distribution

  • Positive charges: 6 total (4 Lys + 2 Arg)
  • Net charge: Strongly positive at physiological pH
  • Electrostatic attraction: Binds negatively charged membranes
  • pI = 12.1: Positive at all biological pH values

Hydrophobicity

  • Wimley-White ΔG:
    Residues 1-20: ~ -4 kcal/mol (hydrophobic overall)

    Residues 21-26: ~ +11 kcal/mol (very hydrophilic overall)
  • Hydrophobic moment: μH = 0.52 (high amphipathicity)
  • HPLC retention: Long retention time in RP-HPLC
  • Membrane affinity: Partitions strongly into lipid bilayers
  • Critical for activity: Hydrophobic residues drive insertion

Mechanism of Action

Step-by-Step Membrane Disruption

1
Electrostatic Attraction
Positively charged melittin (+7 at pH 7.4) is attracted to negatively charged lipid headgroups (phosphatidylserine, phosphatidylglycerol in bacterial membranes).
2
Surface Binding
Melittin binds parallel to membrane surface (S-state). The amphipathic helix aligns with hydrophobic face toward lipids, charged face toward water/headgroups.
3
Membrane Insertion
At critical concentration, melittin reorients perpendicular to membrane (I-state for "inserted"). Multiple helices oligomerize to form transmembrane pores.
4
Pore Formation
4-6 melittin monomers form a toroidal pore (~3-4 nm diameter). Lipid headgroups line the pore interior, with melittin helices embedded in the lipid-water interface.
5
Cell Lysis
Pores allow uncontrolled ion flux, dissipating membrane potential and osmotic balance. Water influx causes cell swelling and eventual lysis (cell death).

Why Melittin is Cytotoxic

Non-Selective Membrane Disruption

Melittin disrupts all biological membranes, not just bacterial:

  • Hemolysis: Lyses red blood cells at low concentrations (µM)
  • Cytotoxicity: Kills mammalian cells (not selective for bacteria)
  • Inflammatory: Activates phospholipase A₂, releases inflammatory mediators
  • Pain: Main component of bee sting pain (activates nociceptors)

Why bacterial selectivity matters: Ideal antimicrobial peptides should kill bacteria but spare mammalian cells. Melittin lacks this selectivity, limiting therapeutic use despite potent antimicrobial activity.

Improving selectivity: Researchers modify melittin's sequence to increase bacterial selectivity by tuning charge, hydrophobicity, and amphipathicity.

Applications Despite Toxicity

Cancer Therapy (Nanoparticle Delivery)
Melittin encapsulated in nanoparticles targets tumor cells, reducing systemic toxicity. Shown efficacy against melanoma, breast cancer, and leukemia in preclinical studies.
Research Tool
Model peptide for studying membrane interactions, pore formation, and amphipathic helix folding. Extensively characterized structurally (NMR, X-ray, MD simulations).
Antimicrobial (Topical Only)
Potential for wound dressings or skin infections where systemic absorption is minimal. Active against MRSA and other resistant bacteria.
Immunomodulation
Low concentrations modulate immune responses. Being investigated for autoimmune diseases and HIV therapy (disrupts viral envelope).

Cell-Penetrating Peptides (CPPs)

Cell-penetrating peptides (CPPs), also called protein transduction domains (PTDs), are short sequences (typically 5-30 amino acids) that can cross cell membranes and deliver cargo into cells.

What Makes Peptides Cell-Penetrating?

1. Positive Charge

Required range: Net charge +6 to +10 at pH 7.4
Why: Interact with negatively charged membrane components (phospholipid headgroups, glycosaminoglycans)
Key residues: Arginine > Lysine (guanidinium forms better H-bonds)

2. Amphipathic Character

Balance needed: Some hydrophobicity for membrane insertion
Ideal: Amphipathic α-helix upon membrane binding
Avoid: Too hydrophobic (aggregates), too hydrophilic (won't insert)

3. Moderate Length

Sweet spot: 10-20 amino acids
Too short (<8): Insufficient membrane interactions
Too long (>30): May adopt stable structure that hinders uptake

4. Sequence Flexibility

Preferred: Lack of rigid secondary structure in solution
Why: Allows conformational adaptation to membrane environment
Avoid: Strong β-sheet formers (aggregation risk)

Mechanisms of Cell Penetration

CPPs can enter cells through multiple pathways, often simultaneously:

Direct Penetration

Process: CPP inserts directly through membrane without endocytosis
Requirements: High peptide concentration, specific lipid composition
Advantages: Rapid, no endosomal entrapment
Mechanism: Possibly via transient pores or membrane destabilization

Endocytosis

Process: Membrane invagination forms vesicles that bring CPP inside
Types: Clathrin-mediated, caveolin-mediated, macropinocytosis
Challenge: Must escape endosome to reach cytoplasm (endosomal escape)
Strategies: pH-sensitive sequences, fusogenic peptides

Classic CPP Examples

TAT Peptide

YGRKKRRQRRR

Origin: HIV TAT protein (residues 47-57)
Charge: +8 (6 Arg, 2 Lys)
Mechanism: Primarily endocytosis, some direct penetration
Use: Most widely studied CPP, delivers proteins, DNA, drugs
Note: Works across diverse cell types

Penetratin (Antennapedia)

RQIKIWFQNRRMKWKK

Origin: Drosophila Antennapedia homeodomain (residues 43-58)
Charge: +7
Structure: Amphipathic α-helix
Mechanism: Inverted micelle formation suggested
Use: Delivers peptide nucleic acids (PNAs), siRNA

Polyarginine (R9)

RRRRRRRRR

Design: Synthetic, all-arginine sequence
Charge: +9
Advantage: Simple, easy to synthesize, highly efficient
Mechanism: Primarily endocytosis via interaction with proteoglycans
Note: Arginine > lysine for cell penetration

Transportan

GWTLNSAGYLLGKINLKALAALAKKIL

Design: Chimera of galanin and mastoparan
Charge: +6
Structure: Amphipathic helix
Mechanism: Both direct penetration and endocytosis
Special: Also antimicrobial (non-selective membrane disruption)

CPP Applications in Drug Delivery

Protein Delivery
CPPs fused to therapeutic proteins enable intracellular delivery. Example: TAT-Cre recombinase for gene editing, TAT-p53 for cancer therapy.
Nucleic Acid Delivery
CPPs condense and deliver DNA, siRNA, antisense oligonucleotides. Electrostatic interaction between cationic CPP and anionic nucleic acids forms nanoparticles.
Small Molecule Drugs
CPPs conjugated to poorly permeable drugs improve bioavailability. Example: CPP-doxorubicin conjugates for enhanced cancer cell uptake.
Imaging Agents
CPPs deliver fluorophores, radiolabels, or MRI contrast agents into cells for diagnostic imaging. Enables visualization of intracellular targets.
Design Tip: Balancing Charge and Hydrophobicity

The ideal CPP strikes a balance:

  • Too hydrophilic: Won't insert into membrane (stays in solution)
  • Too hydrophobic: Aggregates in solution, cytotoxic, non-specific binding
  • Optimal: Amphipathic character allows membrane interaction while maintaining solubility

Rule of thumb: Net charge +6 to +10, include 2-4 hydrophobic residues (Trp, Phe, Leu) distributed to create amphipathicity, avoid large hydrophobic patches.

Antimicrobial Peptides (AMPs)

Antimicrobial peptides are part of innate immunity across all domains of life. These host defense peptides provide rapid, broad-spectrum protection against bacteria, fungi, and viruses.

What Makes AMPs Selective for Bacteria?

Key Difference: Membrane Composition

Bacterial Membranes
  • Outer leaflet: Rich in anionic lipids (phosphatidylglycerol, cardiolipin)
  • Net charge: Strongly negative
  • Consequence: Attracts cationic AMPs via electrostatics
Mammalian Membranes
  • Outer leaflet: Zwitterionic lipids (phosphatidylcholine, sphingomyelin)
  • Net charge: Nearly neutral
  • Consequence: Weaker attraction to cationic AMPs
  • Additional protection: Cholesterol stabilizes membrane

Selectivity mechanism: Cationic AMPs preferentially bind to anionic bacterial membranes. At appropriate concentrations, they kill bacteria while sparing host cells.

AMP Families

Defensins

Structure: 3-4 disulfide bonds forming stable β-sheet structure
Size: 18-45 amino acids
Charge: +4 to +8
Examples: Human α-defensins (HD-5, HD-6), β-defensins (HBD-1, HBD-2)
Location: Neutrophils, epithelial surfaces, Paneth cells
Mechanism: Pore formation, membrane permeabilization

Cathelicidins

Structure: α-helical in membrane-bound form
Size: 12-80 amino acids
Example: LL-37 (human), only human cathelicidin
Sequence (LL-37): [LL-37, 37 aa]
Charge: +6
Special: Also immunomodulatory (chemotaxis, wound healing)

Magainins

Origin: African clawed frog (Xenopus laevis) skin
Structure: Amphipathic α-helix
Size: 23 amino acids
Charge: +3 to +5
Example: Magainin 2
Activity: Broad-spectrum, low toxicity to mammalian cells
Note: Inspiration for pexiganan (synthetic derivative, clinical trials)

Cecropins

Origin: Insect hemolymph
Structure: Two amphipathic helices connected by hinge
Size: 31-39 amino acids
Charge: +5 to +8
Mechanism: Carpet model (detergent-like disruption)
Special: Active against Gram-negative bacteria

Common Structural Features of AMPs

Beyond Bacteria: Broad Antimicrobial Activity

Antifungal
Many AMPs active against Candida, Aspergillus. Mechanism similar to antibacterial (membrane disruption). Example: Histatin-5 in human saliva.
Antiviral
Some AMPs disrupt viral envelopes or interfere with viral fusion. Example: Defensins inhibit HIV, influenza. Less studied than antibacterial activity.
Antiparasitic
Several AMPs kill parasites (Plasmodium, Trypanosoma). Potential for treating malaria, sleeping sickness. Mechanism: membrane permeabilization.
Anticancer
Cancer cells often expose anionic phosphatidylserine on outer leaflet (unlike healthy cells). Some AMPs selectively kill cancer cells. Example: LL-37, temporins.

Membrane Disruption Mechanisms

AMPs and membrane-active peptides disrupt bilayers through several distinct mechanisms. Understanding these helps design peptides with desired selectivity and potency.

1. Barrel-Stave Model

Barrel-Stave Model

Process: Peptides insert perpendicular to membrane, forming transmembrane pore with hydrophobic faces toward lipids, hydrophilic faces lining pore interior.

Requirements: Long peptides (20-30 aa), high hydrophobic moment, stable helices

Examples: Alamethicin, some synthetic peptides

2. Toroidal (Wormhole) Pore

Toroidal Pore Model

Process: Peptides induce membrane curvature, lipid headgroups line pore along with peptides (toroidal geometry).

Difference from barrel-stave: Lipids participate in pore structure (not just peptides)

Examples: Melittin, magainin, protegrin

3. Carpet Model

Carpet Model

Process: Peptides accumulate parallel to membrane surface at high concentration, acting like detergent. Membrane disintegrates into micelles.

No defined pores: General membrane disruption/solubilization

Examples: Cecropins, dermcidin, some short AMPs

4. Detergent-Like Disruption

Detergent-Like Model

Process: At very high peptide:lipid ratios, membrane is completely solubilized into mixed peptide-lipid micelles.

Characteristic: Threshold concentration needed, rapid disruption

Examples: Highly amphipathic short peptides, extreme conditions

Which Mechanism When?

Factors Determining Mechanism
  • Peptide concentration: Low = pores, high = carpet/detergent
  • Peptide length: Long = barrel-stave, short = carpet
  • Amphipathicity: High μH = toroidal pores, moderate = carpet
  • Membrane composition: Anionic lipids favor pore formation
  • Peptide structure: Rigid helices = barrel-stave, flexible = toroidal/carpet

Important: A single peptide may use different mechanisms depending on conditions! For example, melittin uses toroidal pores at low concentration but carpet model at high concentration.

Membrane Binding vs Penetration

Not all membrane-interactive peptides penetrate fully. Understanding the difference helps design peptides for specific functions.

Surface Binding (Peripheral)

Location: Peptide remains at membrane-water interface
Orientation: Usually parallel to membrane surface
Depth: Shallow (~5-10 Å from surface)
Driving force: Electrostatic attraction + shallow hydrophobic insertion

Typical properties:
• High charge, moderate hydrophobicity
• Amphipathic helix
• Charge > hydrophobicity

Examples: Initial binding of melittin, many AMP intermediates

Transmembrane Insertion (Integral)

Location: Peptide spans membrane
Orientation: Perpendicular to membrane surface
Depth: Full bilayer thickness (~30-40 Å)
Driving force: Hydrophobic effect dominates

Typical properties:
• High hydrophobicity
• Sufficient length to span bilayer (≥18-20 aa as helix)
• Hydrophobicity > charge

Examples: Transmembrane domains of receptors, melittin pores, alamethicin

Depth of Insertion

The extent of membrane penetration depends on peptide properties:

Surface Only
Headgroup region
0-5 Å depth
Very hydrophilic peptides
Shallow Insertion
Glycerol backbone
5-15 Å depth
Amphipathic peptides
Deep Insertion
Hydrocarbon core
15-25 Å depth
Hydrophobic peptides
Transmembrane
Spans bilayer
~30-40 Å
Very hydrophobic, long peptides
Experimental Techniques to Measure Depth
  • Fluorescence quenching: Depth-dependent quenching by brominated lipids
  • Solid-state NMR: Orientation and depth from ³¹P, ²H NMR
  • EPR spectroscopy: Spin-labeled lipids at different depths
  • X-ray/neutron diffraction: Electron density profiles show peptide location
  • MD simulations: Computational prediction of insertion depth

Designing Membrane-Active Peptides

Rational design of membrane-active peptides requires balancing multiple properties. Here are evidence-based guidelines for different applications.

Design Principles by Application

For Cell-Penetrating Peptides (CPPs)

Charge Optimization:
  • Net charge: +6 to +10
  • Prefer Arg over Lys (guanidinium H-bonding)
  • Distribute charges evenly (avoid clustering)
Hydrophobicity:
  • Include 20-40% hydrophobic residues
  • Prefer Trp, Phe (aromatic stacking with membrane)
  • Avoid large hydrophobic patches (aggregation)
Length:
  • Optimal: 10-20 amino acids
  • Too short (<8): Inefficient
  • Too long (>30): May fold, reducing flexibility
Structure:
  • Flexible in solution, folds at membrane
  • Avoid strong β-sheet formers
  • Amphipathic helix ideal

For Selective Antimicrobial Peptides

Bacterial Selectivity:
  • Net charge: +2 to +6 (optimal +4)
  • Too high charge: Binds mammalian cells too
  • Include hydrophobic residues: 40-60%
Amphipathicity:
  • Hydrophobic moment μH: 0.4-0.6
  • Clear segregation of faces
  • Use helical wheel to verify
Avoid Hemolysis:
  • Keep total hydrophobicity moderate
  • Avoid very long (>30 aa) sequences
  • Test against RBCs early in development
Sequence Patterns:
  • Alternate charged/hydrophobic (e.g., KLKLKLKL)
  • Or block design with distinct regions
  • Include helix-stabilizing residues (Ala, Leu)

For Membrane-Disrupting Peptides

High Activity (Non-Selective):
  • Charge: +6 to +8
  • Hydrophobicity: 50-70%
  • Strong amphipathicity (μH > 0.5)
  • Length: 20-30 aa for pore formation
Structure:
  • α-helical at membranes
  • Unstructured in solution (membrane-induced folding)
  • Flexible hinge regions allowed (e.g., Pro, Gly)
Warning:
  • High potency = high toxicity
  • Limit systemic use
  • Consider nanoparticle encapsulation

For Membrane Anchors/Targeting

Stable Membrane Association:
  • High hydrophobicity (ΔG < -10 kcal/mol)
  • Length: ≥20 aa to span bilayer if transmembrane
  • Or 10-15 aa for peripheral anchors
Transmembrane Domains:
  • Mostly hydrophobic (Leu, Ile, Val, Ala)
  • α-helical (stable in membrane)
  • Minimal charged residues in core
  • Flanking charged residues (stop transfer)
Peripheral Anchors:
  • Amphipathic helix
  • Hydrophobic face inserts, polar face exposed
  • Examples: Lipid-binding domains, ApoA-I

Common Design Mistakes to Avoid

❌ Too Hydrophobic
Problem: Aggregates in solution, difficult to work with, cytotoxic
Solution: Include polar residues, limit hydrophobic patches, use spacers
❌ Too Hydrophilic
Problem: Won't insert into membrane, stays in solution
Solution: Add hydrophobic residues (Trp, Phe, Leu) for amphipathicity
❌ Ignoring Amphipathicity
Problem: Random distribution doesn't create functional structure
Solution: Design with helical wheel, ensure segregation of properties
❌ Wrong Length
Problem: Too short (inactive) or too long (expensive, immunogenic)
Solution: Start with 15-20 aa, optimize based on activity
✅ Iterative Optimization
Best approach: Start with template (TAT, melittin, magainin), make systematic changes, test activity, adjust. Use PepDraw to calculate properties before synthesis!
✅ Test Early, Test Often
Critical assays: Membrane binding (fluorescence), cell penetration (flow cytometry), toxicity (hemolysis, MTT), antimicrobial (MIC). Catch problems early!

Interactive Tools

Use these calculators to evaluate peptide hydrophobicity and amphipathicity:

Calculator 1: Wimley-White Hydrophobicity

Calculate transfer free energy (ΔG) from water to membrane interface:

Calculator 2: Amphipathicity Analyzer

Analyze hydrophobic/hydrophilic distribution and calculate hydrophobic moment:

References

1. Wimley-White Hydrophobicity Scale
Wimley, W. C., & White, S. H. (1996). Experimentally determined hydrophobicity scale for proteins at membrane interfaces. Nature Structural Biology, 3(10), 842-848. doi:10.1038/nsb1096-842
2. Melittin Structure and Function
Raghuraman, H., & Chattopadhyay, A. (2007). Melittin: a membrane-active peptide with diverse functions. Bioscience Reports, 27(4-5), 189-223. doi:10.1007/s10540-006-9030-z
3. Cell-Penetrating Peptides Review
Milletti, F. (2012). Cell-penetrating peptides: classes, origin, and current landscape. Drug Discovery Today, 17(15-16), 850-860. doi:10.1016/j.drudis.2012.03.002
4. Antimicrobial Peptides Mechanisms
Yeaman, M. R., & Yount, N. Y. (2003). Mechanisms of antimicrobial peptide action and resistance. Pharmacological Reviews, 55(1), 27-55. doi:10.1124/pr.55.1.2
5. Amphipathic Helices in Membrane Proteins
Segrest, J. P., De Loof, H., Dohlman, J. G., Brouillette, C. G., & Anantharamaiah, G. M. (1990). Amphipathic helix motif: classes and properties. Proteins: Structure, Function, and Bioinformatics, 8(2), 103-117. doi:10.1002/prot.340080202
6. Membrane Disruption Models
Brogden, K. A. (2005). Antimicrobial peptides: pore formers or metabolic inhibitors in bacteria? Nature Reviews Microbiology, 3(3), 238-250. doi:10.1038/nrmicro1098
Advertisement

Continue Learning

Explore more topics in peptide chemistry and analysis: