Ads help keep PepDraw free for researchers worldwide. Please whitelist this site, or go ad-free with PepDraw Plus.
Understanding how peptides interact with lipid membranes
Hydrophobicity (from Greek: hydro = water, phobos = fear) describes the tendency of nonpolar molecules or molecular regions to avoid contact with water and instead associate with other nonpolar entities, including lipid membranes.
The hydrophobic effect is fundamentally entropy-driven, not "water-hating." When nonpolar molecules dissolve in water, water molecules must form ordered cage-like structures (clathrates) around them, which decreases entropy. By clustering together, hydrophobic molecules minimize the ordered water surface, increasing overall system entropy.
Thermodynamics:
ΔG = ΔH - TΔS
For the hydrophobic effect: ΔH ≈ 0, but TΔS > 0 (favorable entropy increase)
Therefore: ΔG < 0 (spontaneous clustering)
Several scales have been developed to assign numerical hydrophobicity values to amino acids. Each scale is based on different experimental approaches:
Method: Based on vapor-phase transfer and protein structure analysis
Range: -4.5 (Arg, most hydrophilic) to +4.5 (Ile, most hydrophobic)
Use: Predicting transmembrane regions in proteins
Published: 1982
Method: Normalized consensus from multiple hydrophobicity scales
Range: -1.0 to +1.0 (normalized)
Use: Helical wheel projections, amphipathicity analysis
Published: 1984
Method: Experimental water→membrane transfer free energy (ΔG)
Range: -1.0 to +3.0 kcal/mol
Use: Most accurate for membrane insertion predictions
Published: 1996
Why PepDraw uses it: Direct thermodynamic measurement, most biologically relevant
The Wimley-White scale reports the free energy change (ΔG) for transferring an amino acid from water into a lipid bilayer interface, measured in kcal/mol:
For peptides: Sum the ΔG values for all residues. More negative = more hydrophobic = greater tendency to partition into membranes.
Hydrophobicity can be measured experimentally or calculated from sequence. Each method provides different but complementary information.
Principle: Measure the distribution of a peptide between water and octanol (a nonpolar solvent that mimics membrane interior).
Advantages: Direct thermodynamic measurement
Limitations: Octanol ≠ real membrane (lacks charge, different structure)
Principle: Hydrophobic peptides bind more strongly to the nonpolar stationary phase and elute later (longer retention time).
Advantages: Easy, fast, reproducible, correlates well with membrane affinity
Use: Predict membrane-binding peptides, optimize synthesis
Principle: Directly measure the energy required to move peptide from water into lipid vesicles using equilibrium dialysis or isothermal titration calorimetry (ITC).
Advantages: Most biologically relevant, accounts for real membrane properties
Gold standard: This is how Wimley-White scale was derived
Calculated hydrophobicity (summing per-residue values) assumes:
Reality: Calculated values are useful estimates but can differ significantly from experimental measurements. For critical applications, validate experimentally!
An amphipathic helix (also called amphiphilic helix) is an α-helix with distinct hydrophobic and hydrophilic faces. This structural motif is crucial for membrane interactions and protein function.
A helical wheel is a 2D projection looking down the helix axis, showing which residues face which direction. This visualization reveals amphipathicity:
Melittin is the principal toxic component of bee venom and serves as the archetypal amphipathic, membrane-disrupting peptide. Its well-studied properties make it an ideal teaching example.
Melittin disrupts all biological membranes, not just bacterial:
Why bacterial selectivity matters: Ideal antimicrobial peptides should kill bacteria but spare mammalian cells. Melittin lacks this selectivity, limiting therapeutic use despite potent antimicrobial activity.
Improving selectivity: Researchers modify melittin's sequence to increase bacterial selectivity by tuning charge, hydrophobicity, and amphipathicity.
Cell-penetrating peptides (CPPs), also called protein transduction domains (PTDs), are short sequences (typically 5-30 amino acids) that can cross cell membranes and deliver cargo into cells.
Required range: Net charge +6 to +10 at pH 7.4
Why: Interact with negatively charged membrane components
(phospholipid headgroups, glycosaminoglycans)
Key residues: Arginine > Lysine (guanidinium forms better H-bonds)
Balance needed: Some hydrophobicity for membrane insertion
Ideal: Amphipathic α-helix upon membrane binding
Avoid: Too hydrophobic (aggregates), too hydrophilic (won't insert)
Sweet spot: 10-20 amino acids
Too short (<8): Insufficient membrane interactions
Too long (>30): May adopt stable structure that hinders uptake
Preferred: Lack of rigid secondary structure in solution
Why: Allows conformational adaptation to membrane environment
Avoid: Strong β-sheet formers (aggregation risk)
CPPs can enter cells through multiple pathways, often simultaneously:
Process: CPP inserts directly through membrane without endocytosis
Requirements: High peptide concentration, specific lipid composition
Advantages: Rapid, no endosomal entrapment
Mechanism: Possibly via transient pores or membrane destabilization
Process: Membrane invagination forms vesicles that bring CPP inside
Types: Clathrin-mediated, caveolin-mediated, macropinocytosis
Challenge: Must escape endosome to reach cytoplasm (endosomal escape)
Strategies: pH-sensitive sequences, fusogenic peptides
Origin: HIV TAT protein (residues 47-57)
Charge: +8 (6 Arg, 2 Lys)
Mechanism: Primarily endocytosis, some direct penetration
Use: Most widely studied CPP, delivers proteins, DNA, drugs
Note: Works across diverse cell types
Origin: Drosophila Antennapedia homeodomain (residues 43-58)
Charge: +7
Structure: Amphipathic α-helix
Mechanism: Inverted micelle formation suggested
Use: Delivers peptide nucleic acids (PNAs), siRNA
Design: Synthetic, all-arginine sequence
Charge: +9
Advantage: Simple, easy to synthesize, highly efficient
Mechanism: Primarily endocytosis via interaction with proteoglycans
Note: Arginine > lysine for cell penetration
Design: Chimera of galanin and mastoparan
Charge: +6
Structure: Amphipathic helix
Mechanism: Both direct penetration and endocytosis
Special: Also antimicrobial (non-selective membrane disruption)
The ideal CPP strikes a balance:
Rule of thumb: Net charge +6 to +10, include 2-4 hydrophobic residues (Trp, Phe, Leu) distributed to create amphipathicity, avoid large hydrophobic patches.
Antimicrobial peptides are part of innate immunity across all domains of life. These host defense peptides provide rapid, broad-spectrum protection against bacteria, fungi, and viruses.
Selectivity mechanism: Cationic AMPs preferentially bind to anionic bacterial membranes. At appropriate concentrations, they kill bacteria while sparing host cells.
Structure: 3-4 disulfide bonds forming stable β-sheet structure
Size: 18-45 amino acids
Charge: +4 to +8
Examples: Human α-defensins (HD-5, HD-6), β-defensins (HBD-1, HBD-2)
Location: Neutrophils, epithelial surfaces, Paneth cells
Mechanism: Pore formation, membrane permeabilization
Structure: α-helical in membrane-bound form
Size: 12-80 amino acids
Example: LL-37 (human), only human cathelicidin
Sequence (LL-37): [LL-37, 37 aa]
Charge: +6
Special: Also immunomodulatory (chemotaxis, wound healing)
Origin: African clawed frog (Xenopus laevis) skin
Structure: Amphipathic α-helix
Size: 23 amino acids
Charge: +3 to +5
Example: Magainin 2
Activity: Broad-spectrum, low toxicity to mammalian cells
Note: Inspiration for pexiganan (synthetic derivative, clinical trials)
Origin: Insect hemolymph
Structure: Two amphipathic helices connected by hinge
Size: 31-39 amino acids
Charge: +5 to +8
Mechanism: Carpet model (detergent-like disruption)
Special: Active against Gram-negative bacteria
AMPs and membrane-active peptides disrupt bilayers through several distinct mechanisms. Understanding these helps design peptides with desired selectivity and potency.
Process: Peptides insert perpendicular to membrane, forming transmembrane pore with hydrophobic faces toward lipids, hydrophilic faces lining pore interior.
Requirements: Long peptides (20-30 aa), high hydrophobic moment, stable helices
Examples: Alamethicin, some synthetic peptides
Process: Peptides induce membrane curvature, lipid headgroups line pore along with peptides (toroidal geometry).
Difference from barrel-stave: Lipids participate in pore structure (not just peptides)
Examples: Melittin, magainin, protegrin
Process: Peptides accumulate parallel to membrane surface at high concentration, acting like detergent. Membrane disintegrates into micelles.
No defined pores: General membrane disruption/solubilization
Examples: Cecropins, dermcidin, some short AMPs
Process: At very high peptide:lipid ratios, membrane is completely solubilized into mixed peptide-lipid micelles.
Characteristic: Threshold concentration needed, rapid disruption
Examples: Highly amphipathic short peptides, extreme conditions
Important: A single peptide may use different mechanisms depending on conditions! For example, melittin uses toroidal pores at low concentration but carpet model at high concentration.
Not all membrane-interactive peptides penetrate fully. Understanding the difference helps design peptides for specific functions.
Location: Peptide remains at membrane-water interface
Orientation: Usually parallel to membrane surface
Depth: Shallow (~5-10 Å from surface)
Driving force: Electrostatic attraction + shallow hydrophobic insertion
Typical properties:
• High charge, moderate hydrophobicity
• Amphipathic helix
• Charge > hydrophobicity
Examples: Initial binding of melittin, many AMP intermediates
Location: Peptide spans membrane
Orientation: Perpendicular to membrane surface
Depth: Full bilayer thickness (~30-40 Å)
Driving force: Hydrophobic effect dominates
Typical properties:
• High hydrophobicity
• Sufficient length to span bilayer (≥18-20 aa as helix)
• Hydrophobicity > charge
Examples: Transmembrane domains of receptors, melittin pores, alamethicin
The extent of membrane penetration depends on peptide properties:
Rational design of membrane-active peptides requires balancing multiple properties. Here are evidence-based guidelines for different applications.
Use these calculators to evaluate peptide hydrophobicity and amphipathicity:
Calculate transfer free energy (ΔG) from water to membrane interface:
Analyze hydrophobic/hydrophilic distribution and calculate hydrophobic moment:
Explore more topics in peptide chemistry and analysis: